DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG4053

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:251 Identity:64/251 - (25%)
Similarity:101/251 - (40%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 TRNKRTKPTGVKD------LDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPV 472
            ||.||.....:.|      .:|.....|:|..| :...||.||.|.|:.:|::|::..|.....:
  Fly    20 TRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSI-QTIWKTHICSGVILNEQWILTAGHCALDFSI 83

  Fly   473 TDIRVKAGEWELGSTNEPL-PFQLTGVKTVDVHPDYD-PSTNSHDLAIIRLERRLEFASHIQPIC 535
            .|:|:..|      ||:.| |.|........||..|| |...::|:|:|.:...:.|....|.:.
  Fly    84 EDLRIIVG------TNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVE 142

  Fly   536 ISDEDPKDSEQCFTSGWGKQALSIHEEGALMHVTDTLPQARSEC--------SADSSSVCSATK- 591
            :|.|.|........:|||....|......|..:..|: .|..||        ..|...:|:.|: 
  Fly   143 LSREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTI-IAHEECRERWDFHDGIDIGHICTFTRE 206

  Fly   592 -FDSCQFDVGSALACGSGSSVRLKGIFAGENSCGEGQTVRFAKPDIKWINTAFAEN 646
             ..:|..|.|..|....    :|.|:.....:||.|.      ||: :.||.:.::
  Fly   207 GEGACSGDSGGPLMWEG----KLVGLVNWGRACGVGM------PDM-YANTVYYQD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 51/199 (26%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 59/237 (25%)
Tryp_SPc 35..256 CDD:238113 59/236 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.