DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG17475

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:210 Identity:55/210 - (26%)
Similarity:84/210 - (40%) Gaps:32/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 ICGGAIIGDQFVLSSASCVNGLPVTDIRVKAG--EWELGSTNEPLPFQLTGVKTVDVHPDYDPST 511
            ||||.||.::.||::|.||.|...|.:||..|  |:|       .|..:..|:...:|.:|:...
  Fly    75 ICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYE-------KPDAVYFVEEHWIHCNYNSPD 132

  Fly   512 NSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQCFTSGWGKQAL-----SIHEEGALMHVTDT 571
            ..:|:|:|||...::|..:.||..:......:..|...:|||...|     .|.::..|.||   
  Fly   133 YHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHV--- 194

  Fly   572 LPQARSECSADSSSVCSATKFDSCQFDVGSALAC--GSGSSVRLKGIFAGENSCGEGQTVRFAKP 634
               ..|.|....::..|......|....|...||  .||..:...|:..|  ....|.......|
  Fly   195 ---VYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYG--LVNWGYPCALGVP 254

  Fly   635 D--------IKWINT 641
            |        ::||.:
  Fly   255 DSHANVYYYLEWIRS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 48/175 (27%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 53/206 (26%)
Tryp_SPc 50..269 CDD:238113 55/208 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.