DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG31265

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:281 Identity:62/281 - (22%)
Similarity:111/281 - (39%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 PGKCCRDPNYVDPWPVNLAGVCATRNKRTKPTGVKDLDANFAEIPWQAMILRESSKTLI----CG 451
            |...|.....|.|:|...:|       |.|  |.::.:..||  |:|.     |.:.::    ||
  Fly    16 PPNPCESKRIVGPFPAGQSG-------RIK--GGEEAEIGFA--PYQV-----SLQPIVGSHNCG 64

  Fly   452 GAIIGDQFVLSSASCV-NGLP-VTDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSH 514
            |||:.:.:::::..|| |.:| :.::.....:|.     ||.....|.  .:..|..||.....:
  Fly    65 GAILNENWIITAGHCVENFIPALVNVITGTNKWA-----EPGAIYYTA--EIHKHCMYDQPYMHN 122

  Fly   515 DLAIIRLERRLEFASHIQPICISDEDPKDSEQCFTSGWGKQAL------SIHE-EGALMHVTDTL 572
            |:|:::|...:.|....|||.:.....:..|:...:|||....      .:|: ...|:.:.:..
  Fly   123 DIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECY 187

  Fly   573 PQARSECSADSSSVCSATK--FDSCQFDVGSALACGSGSSVRLKGIFAGENSCGEGQTVRFAKPD 635
            .......|.....:|:.::  ..:|..|.|..|.    |:.:|.|:......||.|      .||
  Fly   188 ETFNRTSSMGVGHICTFSREGEGACHGDSGGPLV----SNGQLVGVVNWGRPCGVG------LPD 242

  Fly   636 IK--------WINTAFAENNK 648
            ::        ||.:..:.|||
  Fly   243 VQANVYYYLDWIRSKLSGNNK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 42/202 (21%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 51/243 (21%)
Tryp_SPc 39..257 CDD:238113 51/241 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.