DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and modSP

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:664 Identity:137/664 - (20%)
Similarity:205/664 - (30%) Gaps:218/664 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 FLKCAPGQQCVRSGQCLNGYFAQQLPKIQNC----DPETTVC-------------CTYRPPPTTT 128
            |..|...|....:|.|::.|......|  ||    |.....|             |||   ....
  Fly    24 FAACDSSQFECDNGSCISQYDVCNGEK--NCPDGSDETALTCVSQRQHCTKPYFQCTY---GACV 83

  Fly   129 TTTTTSVPVANCAYDSD-----CVTPD-----------NCRNGEISAINYVKKQGPNRCPAPNIC 177
            ..|.....|..||..||     |...|           ||:..|.            :||:.  .
  Fly    84 IGTAGCNGVNECADGSDETRLRCGNEDDIRQHDRRLQGNCKENEF------------KCPSG--I 134

  Fly   178 CRIPSTTLTE------DGYIFN----------LPEKTFPLPTKPAVLAM-----------PSTQA 215
            |...|..|.:      ||..|:          .|..:|...|...:...           .|.:|
  Fly   135 CLDKSNFLCDGKDDCADGTGFDESVELCGHMECPAYSFKCGTGGCISGSLSCNGENDCYDGSDEA 199

  Fly   216 PFRPQPTTAVPASRPTIEYLPPSTTQHPSYEKVQTSRRPVYLPPSPATESASSLIPKIRPRPEPR 280
            |                  |..:||     :||.|   ||      .||:...|:....|..:.|
  Fly   200 P------------------LLCNTT-----KKVTT---PV------VTETPLELLGCPLPLGDER 232

  Fly   281 PQPTRRPTNEYLPPAAANEIPRFEPDRAPQPSNQKPIYRGEDQLSPQIFPTPQPANVPKHFAKCA 345
            |..|...:.....|.....: ||...:......::..|..:::.|....|            ||.
  Fly   233 PILTGDGSRVLTGPITRGTV-RFSCKQGYVLEGEESSYCAKNKWSTSTIP------------KCV 284

  Fly   346 SALVCTSENFCNAIGVLSETPVELSPMEAAFRVPLTDCLQTENGSPGKCCRDPNYVDPWPVNLAG 410
                    .:|:..|              .|....|..|.|.||...: ||.|.:  |....:..
  Fly   285 --------KYCSTAG--------------EFDGYSTKALCTHNGQQVE-CRKPFH--PPGTEVKF 324

  Fly   411 VCATRNKRTKP---------------------------TGVKDLDA-----NFAEIPWQAMIL-- 441
            ||:|..|...|                           |.:|...:     |...:||...:.  
  Fly   325 VCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVW 389

  Fly   442 -RESSKTLICGGAIIGDQFVLSSASCV----NGLPVT--DIRVKAGEW--ELGSTNEPLPFQLTG 497
             .|......|||:::....|:::|.||    ..||.:  ..||.|.::  ..|.|..  ..:...
  Fly   390 HNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTP--EEKRRD 452

  Fly   498 VKTVDVHPDYDPSTNSH--DLAIIRLERRLEFASHIQPICIS------DEDPKDSEQCFTSGWGK 554
            |:.:::.|.|...|.::  |||::.|:...|.:..|:|||::      .|...|..|...:||..
  Fly   453 VRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNI 517

  Fly   555 QALSIHEEGALMHVTDTLPQARSECSADSSSVCSATKFDSCQFDVGSALACGSGSSVRLKGIFAG 619
            :  :.||    :.....:.::.|.|..:...: .|.||  |.|..|.:|||...|.    |.|..
  Fly   518 E--NKHE----LQFVPAVSKSNSVCRRNLRDI-QADKF--CIFTQGKSLACQGDSG----GGFTS 569

  Fly   620 E---NSCGEGQTVR 630
            |   |:.....|.|
  Fly   570 ELPTNAFSTWNTAR 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908 26/146 (18%)
Tryp_SPc 428..616 CDD:238113 50/211 (24%)
modSPNP_536776.2 LDLa 27..58 CDD:197566 8/32 (25%)
LDLa 70..101 CDD:197566 8/33 (24%)
LDLa 123..157 CDD:197566 10/47 (21%)
LDLa 167..199 CDD:238060 4/31 (13%)
CCP <251..284 CDD:153056 6/45 (13%)
Sushi 309..354 CDD:278512 9/47 (19%)
Tryp_SPc 371..616 CDD:214473 56/228 (25%)
Tryp_SPc 371..591 CDD:304450 56/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.