DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG3505

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:264 Identity:65/264 - (24%)
Similarity:103/264 - (39%) Gaps:67/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 DLDANFAEIPWQAMI---LRESSKTLICGGAIIGDQFVLSSASCV-----NGLPVTDIRVKAGEW 482
            |.|....|.||.|:|   .....|...|||.:|.|::||::|.||     :.|.:|.:|:  |||
  Fly   110 DTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRL--GEW 172

  Fly   483 ELGSTNEPL-------------PFQLTGVKTVDVHPDYDPS--TNSHDLAIIRLERRLEFASHIQ 532
            :. |||...             |:|...::.:..||.|:.:  |..:|:|::||....:....:|
  Fly   173 DT-STNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQ 236

  Fly   533 PICISDEDPK--DSEQCFT--SGW----------GKQALSIHEEGALMHVTDTLPQARSECSADS 583
            |||:.::..:  :.|...|  :||          |...:|..||....:       |..:....:
  Fly   237 PICLPNKQLRADELEDLVTEVAGWQASSSQRMRKGYVTISSIEECQRKY-------ASQQLRIQA 294

  Fly   584 SSVCSATKFDSCQFDVGSALACGSGSSVRLKGIFA-GENSCGEGQTVRFAKPD-----------I 636
            |.:|..|....|..:.|..|.........|.|:.: |...|        ..||           |
  Fly   295 SKLCGLTNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPC--------PNPDWPDVYTRVASYI 351

  Fly   637 KWIN 640
            .||:
  Fly   352 DWIH 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 56/224 (25%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 64/263 (24%)
Tryp_SPc 111..354 CDD:214473 62/260 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.