DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG8329

DIOPT Version :10

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:226 Identity:62/226 - (27%)
Similarity:94/226 - (41%) Gaps:51/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 LAGVCATRNK-RT--KPTGVKDLDAN-----FAEIPWQAMILRESSKTLICGGAIIGDQFVLSSA 464
            :|.|||.||: ||  ...|.||:..|     ..:.|: |:.||.::.. :.||::||:.:||::|
  Fly    12 VATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPY-AVGLRMNNGA-VGGGSVIGNNWVLTAA 74

  Fly   465 SCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDV-----HPDYDPSTNSHDLAIIRLERR 524
            .|   |....:.:..|      :|.....||.  .||:.     ||.| |::..||:.:||.. .
  Fly    75 HC---LTTDSVTIHYG------SNRAWNGQLQ--HTVNKNNFFRHPGY-PNSAGHDIGLIRTP-Y 126

  Fly   525 LEFASHIQPICISDEDPKDSEQ--------CFTSGWGKQALSIHEEGAL---MHVTDTLPQARSE 578
            :.|.:.|..:.:    ||.|::        |...|||..|     .|.|   :...|....:..|
  Fly   127 VSFTNLINKVSL----PKFSQKGERFENWWCVACGWGGMA-----NGGLADWLQCMDVQVISNGE 182

  Fly   579 CSADSSSVCSATKFDSCQFDVGSALACGSGS 609
            |:....||.|.   |.|.........||..|
  Fly   183 CARSYGSVAST---DMCTRATDGKSVCGGDS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 Atrophin-1 <63..>338 CDD:460830
CLIP_SPH_Scar 343..408 CDD:465747 62/226 (27%)
Tryp_SPc 428..616 CDD:238113 51/203 (25%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 51/203 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.