DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG33465

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:181 Identity:43/181 - (23%)
Similarity:78/181 - (43%) Gaps:30/181 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 PWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEW-ELGSTNEPLPFQLTGV 498
            ||.|.|.:.:.  .||.|.::...|||::|||::  ..:.:.|..|.: :....::....:..||
  Fly    46 PWMASIYKNNQ--FICDGTLVHKLFVLTAASCIS--KDSQLYVLFGMYNQYRDASQFFNNEQYGV 106

  Fly   499 KTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPIC-ISDEDPKDS--EQCFTSGWGKQA---- 556
            .....|.::.|:...:|:.::||...:...:||:||| |.|...|.:  |:....||.:|.    
  Fly   107 AVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEAS 171

  Fly   557 --------------LSIHEEGALMHVTD----TLPQARSECSADSSSVCSA 589
                          ...|..|.|:.:.:    ...:.||.|.::|.|..:|
  Fly   172 SQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRDRSFCRSNSGSPLTA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 43/181 (24%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 43/181 (24%)
Tryp_SPc 46..261 CDD:214473 43/181 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.