DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG10469

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:255 Identity:58/255 - (22%)
Similarity:102/255 - (40%) Gaps:69/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 ANFAEIPWQAMIL--RESSK--TLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNE 489
            |...::|:|..:|  .|.||  ..:|||.|:.:::::::|.|:..       .|:..|:      
  Fly    30 AKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQD-------PKSNLWK------ 81

  Fly   490 PLPFQLTGVKTVD------------VHPDYDPSTNSHDLAIIRLERRLEFASHIQPICI-SDEDP 541
             :...:..||:.|            ||..:|..|.::|:|:|:|.::|.|..:|||..: |.:..
  Fly    82 -VLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKT 145

  Fly   542 KDSEQCFTSGWGKQALSIHEEGALMHVTDTLPQARSECS--------------ADSSSVC-SATK 591
            ....:...||||.....:..: .|.::...: .:..||.              ..:..:| .:.|
  Fly   146 YTGRKAIISGWGLTTKQLPSQ-VLQYIRAPI-ISNKECERQWNKQLGGKSKKVVHNGFICIDSKK 208

  Fly   592 FDSCQFDVGSALACGSGSSVRLKGI----FAGENSCGEGQTVRFAKPDI--------KWI 639
            ...|:.|.|..:....||.. |.||    |.||  |      :...||:        |||
  Fly   209 GLPCRGDSGGPMVLDDGSRT-LVGIVSHGFDGE--C------KLKLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 47/218 (22%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 56/253 (22%)
Tryp_SPc 24..260 CDD:238113 58/255 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.