DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG6592

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:256 Identity:63/256 - (24%)
Similarity:106/256 - (41%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 PTGVKDLDANFAE-------IPWQAMILRESSKTLI-CGGAIIGDQFVLSSASCVNGLPVTDIRV 477
            |.|...:|..|..       .|:|..:|.:..|.|. |||::|.|:.|:::|.||      |:..
  Fly   114 PEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCV------DMAK 172

  Fly   478 KA----GEWELGSTNEPLPFQL-TGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICIS 537
            :|    |..|:.:..|....:| ...:...::|.::|.....|:||:||...:.|...|.||.: 
  Fly   173 RALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQL- 236

  Fly   538 DEDPK--------DSEQCFTSGWGKQALSIHE-EGALMHVTDTLPQARSECSAD------SSSVC 587
               ||        .::....||||:.|..:|. ...|.:|...:...|: |.::      .:::|
  Fly   237 ---PKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRT-CKSNFPLSYRGTNIC 297

  Fly   588 SATK--FDSCQFDVGSALACGSGSSVR--LKGI--FAGENSCGEGQTVRFAK--PDIKWIN 640
            ::.:  ..:|..|.|..|......|.:  |.||  |.....|..|....|.|  ..:.||:
  Fly   298 TSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWIS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 52/219 (24%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 58/245 (24%)
Tryp_SPc 123..359 CDD:238113 60/247 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.