DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:276 Identity:65/276 - (23%)
Similarity:103/276 - (37%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 PVNLAGVCATRNKRTKPTGVKDLDANFAEIPWQ-AMILRESSKTLICGGAIIGDQFVLSSASCVN 468
            |::...:.|..|...:.|..|  .|...:.|:| .:....:|.:..|||:||.:.:||::|.|.:
  Fly    24 PIHPRDLPAVTNIEGRITNGK--TATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTS 86

  Fly   469 GLPVTDI------RVKAGEWELGSTNEPLPFQLTGVKTVDV-----HPDYDPSTNSHDLAIIR-- 520
            |.....|      |..|              ||  |:||..     |..|:.....:|:::|:  
  Fly    87 GASAVTIYYGATVRTSA--------------QL--VQTVSADNFVQHASYNSIVLRNDISLIKTP 135

  Fly   521 ------LERRLEFASHIQPICISDEDPKDSEQCFTSGWGKQALSIHEEGALMHVTDTLPQ----- 574
                  |..::|.     |...........:|...|||||.:      .:...|.:||..     
  Fly   136 TVAFTALINKVEL-----PAIAGTYSTYTGQQAIASGWGKTS------DSATSVANTLQYEVFEV 189

  Fly   575 -ARSECS-------ADSSSVCSAT--KFDSCQFDVGSALACGSGSSVRLKGI--FAGENSCGEGQ 627
             :.|:|.       |.::.:|.||  |..:|..|.|..|...|.|  :|.|:  |.....|..|.
  Fly   190 VSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGCESGA 252

  Fly   628 TVRFAKPD--IKWINT 641
            ...|.:..  :.||.|
  Fly   253 PAGFTRVTSYLDWIKT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 52/222 (23%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 59/257 (23%)
Tryp_SPc 40..269 CDD:238113 62/260 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.