DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG13527

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:221 Identity:53/221 - (23%)
Similarity:92/221 - (41%) Gaps:41/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 CGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTV--DVHPDYDPST- 511
            |||.::.:|:|:::|.||.|  .:.|..|| .|.|.....|...:.|..|:|  .|...|.|.. 
  Fly    62 CGGGLLSNQWVITAAHCVMG--QSKIMYKA-RWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNF 123

  Fly   512 ---NSHDLAIIRLERRLEFAS-HIQPICISDEDPKDSEQCFTSGWGKQ----ALSIHEEGALMHV 568
               |:.::|:::|:.::.... .|..:.:..|.||...:....|||:.    .|::|     ::.
  Fly   124 TMHNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVH-----IYQ 183

  Fly   569 TDTLPQARSECSA-----DSSSVCSATK-----FDSCQFDVGSALACGSGSSVRLKGIFAGENSC 623
            .|.:....:.|..     ....:|:...     .:.|..|:||.|..|.    .:.||.|....|
  Fly   184 VDVVLMDNAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLSGK----VVVGIVAYPIGC 244

  Fly   624 G-----EGQTVRFAKPDIKWI-NTAF 643
            |     ...|..|:  .::|| :||:
  Fly   245 GCTNIPSVYTDVFS--GLRWIRHTAY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 42/186 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 51/217 (24%)
Tryp_SPc 43..263 CDD:214473 49/214 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.