DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG30283

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:235 Identity:66/235 - (28%)
Similarity:106/235 - (45%) Gaps:37/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 DANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCV-NGLPVTDIRVKAGEWELGSTNEPL 491
            :|..|..||.||::.|..  ..|||.:|.::|||:||.|: ||    :::|:     ||......
  Fly    48 NAPVASAPWMAMVMGEGG--FHCGGTLITNRFVLTSAHCIANG----ELKVR-----LGVLEREA 101

  Fly   492 PFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDP--KDSEQCF----TS 550
            ..|...|..:.||.||  ..:.||||::||.:|:.::.:|.|||:. .||  |:.::..    |.
  Fly   102 EAQKFAVDAMFVHTDY--YFDQHDLALLRLAKRVHYSDNISPICLL-LDPLVKNIDEHIVKFRTY 163

  Fly   551 GWGKQALSIHEEGALMHVTDTLPQARSECS-------ADSSSVCS-ATKFDSCQFDVGSAL-ACG 606
            ||||  ........::..|......||||:       .:.:.:|: :...::|..|.|..| |..
  Fly   164 GWGK--TESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIV 226

  Fly   607 SGSSVRLKGIFA----GENSCGEGQTVRFAKPDIKWI-NT 641
            :...|::...|.    |...|.:..........:.|| ||
  Fly   227 TYDHVQMVFQFGVTSFGHADCSKATVFTNVMTHLDWIVNT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 59/203 (29%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 62/230 (27%)
Tryp_SPc 43..266 CDD:238113 64/233 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.