DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG10764

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:283 Identity:78/283 - (27%)
Similarity:117/283 - (41%) Gaps:65/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 VNLAGVCATRNKRTK----PTGVKDL-------DANFAEIPWQAMILRESSKTLICGGAIIGDQF 459
            ::|..:|.|.|:..|    |.|:...       ||......|.|.|.  :|....|||.||..:|
  Fly    10 LSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIF--NSSDFQCGGTIIHMRF 72

  Fly   460 VLSSASC-VNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLER 523
            |||:|.| |.|.   |:.|:     ||:.|...|..:..|..|.||.|:..|...:|:.:::|..
  Fly    73 VLSAAHCLVRGY---DLYVR-----LGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSE 129

  Fly   524 RLEFASHIQPICI-SDEDPKDSEQCFTS----GWGKQ--ALSIHEEGALMHVTDTLPQARSEC-- 579
            .:.:...:||||| .|...|.|.:...:    |||.:  .|||     ::.....|...|:||  
  Fly   130 SIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKLSI-----MLQTIYLLHLKRNECKR 189

  Fly   580 ----SADSSSVCSATK-FDSCQFDVGSALACGSGSSVRLKGIFAGENSCGEGQ--TVRFAKPD-- 635
                :.:|..:|:.|| .|:|:.|.|..|:         ..|....|...|.|  .|.|..|:  
  Fly   190 KLNFNLNSRQICAGTKNGDTCRGDSGGPLS---------TNILFPSNKSYEVQLGIVSFGDPECR 245

  Fly   636 -----------IKWINTAFAENN 647
                       :.||::..|.|:
  Fly   246 GVGVYTDVTSYVDWISSTIARND 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 60/202 (30%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 67/246 (27%)
Tryp_SPc 38..263 CDD:238113 69/248 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.