DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG12133

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:287 Identity:72/287 - (25%)
Similarity:118/287 - (41%) Gaps:72/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 VKDLDANFAEIPWQAMILRES-----SKTLICGGAIIGDQFVLSSASCVNGLPVTDI---RVKAG 480
            |..::|...:.||..::..|:     ..:.:|.|::|..::||::|.|:|   |.|.   ||:.|
  Fly    63 VGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLN---VNDFYVARVRLG 124

  Fly   481 EWELGSTNEP----LPFQLTGVK-------TVDV-----HPDYDPSTNSH--DLAIIRLERRLEF 527
            |.:  :.|:|    ||   .|.|       .:||     |..|......|  |:|::||:.|:::
  Fly   125 EHD--TENDPDYTWLP---NGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKY 184

  Fly   528 ASHIQPICI--SDEDPKDSEQCF---TSGWG----KQALSIHEEGALMHVTDTLPQARSEC---- 579
            ...|:||||  ..|....|.:.|   .:|||    :|..::..:|.:..::.      .||    
  Fly   185 TLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSP------DECLNRY 243

  Fly   580 ---SADSSSVCSATKFDSCQF---DVGSALAC----GSGSSVRLKGIFA---GENSCGEGQTVRF 631
               ..|......|..:|....   |.||.|..    |:.....|.||.:   |.:|.|.|..| :
  Fly   244 PTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAV-Y 307

  Fly   632 AKPD--IKWIN---TAFAENNKPLLLK 653
            .|..  .:||.   ...||:.:.:..|
  Fly   308 TKTSSYYEWIKKKINDIAEDERKMKYK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 58/236 (25%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 69/271 (25%)
Tryp_SPc 62..317 CDD:214473 67/268 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.