DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and Jon44E

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:280 Identity:65/280 - (23%)
Similarity:105/280 - (37%) Gaps:80/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 AGVCATRNKRTKPTGVKDL--------------DANFAEIPWQAMILRESSKTLICGGAIIGDQF 459
            |||..:.:.|..|  |||:              .|...:||: .:.|..:.....|||:||...:
  Fly    15 AGVVPSESARAVP--VKDMPRAGKIEGRITNGYPAYEGKIPY-IVGLSFNDGGYWCGGSIIDHTW 76

  Fly   460 VLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPF---------QLT-GVKTVDV--HPDYDPSTN 512
            ||::|.|.|                 |.|..|.:         |.| .|...|:  |||::...|
  Fly    77 VLTAAHCTN-----------------SANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWNDFLN 124

  Fly   513 SHDLAIIRLERRLEFASHIQPICISDEDPKDSEQ--------CFTSGWGKQALSIHEEGA--LMH 567
             :|:|:||:. .::|.|.:..:    |.|..:::        ...||||   |:.:..|.  .::
  Fly   125 -NDIALIRIP-HVDFWSLVNKV----ELPSYNDRYNSYSGWWAVASGWG---LTDNNSGMSNYLN 180

  Fly   568 VTDTLPQARSECS-------ADSSSVCSATK--FDSCQFDVGSALACGSGSSVRLKGI--FAGEN 621
            ..|......::|.       ...:::|..|.  ..||..|.|..|.....:  |:.||  |....
  Fly   181 CVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNN--RIVGIVSFGSGE 243

  Fly   622 SCGEGQTVRFAKPD--IKWI 639
            .|..|:...|.:..  :.||
  Fly   244 GCTAGRPAGFTRVTGYLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 49/218 (22%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 55/251 (22%)
Tryp_SPc 41..266 CDD:238113 57/252 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.