DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and Jon25Bi

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:207 Identity:53/207 - (25%)
Similarity:83/207 - (40%) Gaps:30/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 CGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLT-GVKTVDVHPDYD-PSTN 512
            |||:||...:||::|.|.||.....|...| .|.   ||.    |.| .|.:.|...::: |:.|
  Fly    64 CGGSIIAHDWVLTAAHCTNGASQVTIYYGA-TWR---TNA----QFTHTVGSGDFIQNHNWPNQN 120

  Fly   513 SHDLAIIRLERRLEFASHIQPICISDEDPK----DSEQCFTSGWGKQALSIHEEGALMHVTDTLP 573
            .:|:|:||.. .::|...:..:.:...:.:    |:......|||........:  .|...|...
  Fly   121 GNDIALIRTP-HVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPD--WMECVDLQI 182

  Fly   574 QARSECSADSSS-----VCSATK--FDSCQFDVGSALACGSGSSVRLKGI--FAGENSCGEGQTV 629
            .:.||||....:     :|.:|.  ..:|..|.|..|....|.  ||.|:  :...|.|..|...
  Fly   183 ISNSECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGG--RLVGVTSWVSGNGCTAGLPS 245

  Fly   630 RFAK--PDIKWI 639
            .|.:  ..:.||
  Fly   246 GFTRVTNQLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 46/178 (26%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 51/205 (25%)
Tryp_SPc 37..260 CDD:238113 53/207 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.