DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and Jon25Bii

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:210 Identity:51/210 - (24%)
Similarity:85/210 - (40%) Gaps:32/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 CGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLT---GVKTVDVHPDYDPST 511
            |||:|||..:|:::|.|.:|.....|...| .|.|.:       |.|   |......|.||:.:.
  Fly    71 CGGSIIGHTWVITAAHCTHGAHSVTIYYGA-LWRLQA-------QYTHTVGSGHFRQHSDYNTNN 127

  Fly   512 NSHDLAIIRLERRLEFASHIQPICISDEDPKDSE----QCFTSGWGKQALSIHEEGALMHVTDTL 572
            .::|:::|... .::|...|..:.:.|.:.:...    ....||||:...|......| :..|:.
  Fly   128 LNNDISLINTP-HVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYL-NCVDSQ 190

  Fly   573 PQARSECSA-------DSSSVCSATK--FDSCQFDVGSALACGSGSSVRLKGI--FAGENSCGEG 626
            ...|.|||:       ..:.:|::|.  ..:|..|.|..|.....|  :|.|:  |...:.|..|
  Fly   191 IITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDRS--KLVGVTSFVAASGCTSG 253

  Fly   627 QTVRFAKPD--IKWI 639
            ....|.:..  :.||
  Fly   254 LPDGFTRVTSYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 44/181 (24%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 49/208 (24%)
Tryp_SPc 43..271 CDD:238113 51/210 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.