DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and Jon25Biii

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:213 Identity:51/213 - (23%)
Similarity:82/213 - (38%) Gaps:47/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 CGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSH 514
            |||:||...:||::..|: |...:.|......|.   ||.    |.|  .||. :.::...:|: 
  Fly    62 CGGSIIAHDWVLTAEHCI-GDAASVIVYFGATWR---TNA----QFT--HTVG-NGNFIKHSNA- 114

  Fly   515 DLAIIRLERRLEFASHIQPICISDEDPKDSEQ--------CFTSGWGKQALSIHEEGAL---MHV 568
            |:|:||:. .::|...:..:    |.|..:::        ....|||    ..::...|   :..
  Fly   115 DIALIRIP-HVDFWHMVNKV----ELPSYNDRYNNYNEWWAVACGWG----GTYDGSPLPDWLQC 170

  Fly   569 TDTLPQARSEC-----SADSSSVCSATKFDS---CQFDVGSALACGSGSSVRLKGI--FAGENSC 623
            .|.......||     |...:.:|:.| .|.   |..|.|..|....||  :|.|:  |...|.|
  Fly   171 VDLQIVHNEECGWTYGSVGDNVICTRT-VDGKSICGGDSGGPLVTHDGS--KLVGVSNFVSSNGC 232

  Fly   624 GEGQTVRFAKP--DIKWI 639
            ..|....|.:.  .:.||
  Fly   233 QSGAPAGFQRVTYHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 43/184 (23%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 49/211 (23%)
Tryp_SPc 37..253 CDD:238113 51/213 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.