DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and psh

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:228 Identity:53/228 - (23%)
Similarity:90/228 - (39%) Gaps:75/228 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 CGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLP---FQLTGVKTVDVHPDYDPST 511
            |||::|..:|||::|.|||    ||....|.. .||:.|...|   :|...:::|.:||.| ...
  Fly   172 CGGSLIASRFVLTAAHCVN----TDANTPAFV-RLGAVNIENPDHSYQDIVIRSVKIHPQY-VGN 230

  Fly   512 NSHDLAIIRLERRLEFASHIQPICISDE--DPKDSEQCFTSGWGKQALSIHEEGALMHVTDTLPQ 574
            ..:|:||:.|||.:....:|:|.|:..:  ||..:.:.|.:|||           :::||   .:
  Fly   231 KYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVAGWG-----------VLNVT---TR 281

  Fly   575 ARSE--------------------------------------CSADSSSVCSATKFDS------- 594
            |||:                                      |:.|...:..|.|.||       
  Fly   282 ARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHE 346

  Fly   595 -----CQFDVGSALACGSGSSVRLKGIFAGENS 622
                 ..:.:...::.|.|.:....|::...:|
  Fly   347 LNVEDGMYTIMGVISSGFGCATVTPGLYTRVSS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 51/220 (23%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 53/228 (23%)
Tryp_SPc 144..387 CDD:238113 53/228 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.