Sequence 1: | NP_610180.1 | Gene: | scaf / 35505 | FlyBaseID: | FBgn0033033 | Length: | 655 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573297.1 | Gene: | psh / 32832 | FlyBaseID: | FBgn0030926 | Length: | 394 | Species: | Drosophila melanogaster |
Alignment Length: | 228 | Identity: | 53/228 - (23%) |
---|---|---|---|
Similarity: | 90/228 - (39%) | Gaps: | 75/228 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 450 CGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLP---FQLTGVKTVDVHPDYDPST 511
Fly 512 NSHDLAIIRLERRLEFASHIQPICISDE--DPKDSEQCFTSGWGKQALSIHEEGALMHVTDTLPQ 574
Fly 575 ARSE--------------------------------------CSADSSSVCSATKFDS------- 594
Fly 595 -----CQFDVGSALACGSGSSVRLKGIFAGENS 622 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scaf | NP_610180.1 | FtsK | <198..>334 | CDD:332908 | |
Tryp_SPc | 428..616 | CDD:238113 | 51/220 (23%) | ||
psh | NP_573297.1 | CLIP | 30..79 | CDD:197829 | |
Tryp_SPc | 143..384 | CDD:214473 | 53/228 (23%) | ||
Tryp_SPc | 144..387 | CDD:238113 | 53/228 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45435575 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |