DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG31220

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:295 Identity:78/295 - (26%)
Similarity:123/295 - (41%) Gaps:67/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 CCRDP-NYVDPWPVNLAGVCATRNK---RTKPTGVKDLDANFAEIPWQAMILRES------SKTL 448
            ||..| |.:..:|.  .|...|.|:   .|:|        |..|.||.||:|..:      .:.|
  Fly    81 CCPKPANTLPSYPD--CGKPQTTNRVIGGTEP--------NLNEYPWLAMLLYRNRSAFNPDREL 135

  Fly   449 I--CGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEP-----------LPFQL-TGVK 499
            :  |||::|..::||::|.||....:...||:.||..  :::.|           .|..| ..|:
  Fly   136 VPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHT--TSHNPDCISRGARIVCAPTHLDIDVE 198

  Fly   500 TVDVHPDYDPS--TNSHDLAIIRLERRLEFASHIQPICISDEDPKD--SEQCFTSGWGKQALSIH 560
            ::..|.||||:  |..:|:|::||:..:.:.....|||:.|. |:.  ..:.:.:||||..:...
  Fly   199 SITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDY-PRSLMKFKMYVAGWGKTGMFDT 262

  Fly   561 EEGALMHVTDTLPQARSECSADSS--------SVCSA--TKFDSCQFDVGSALACGSGSSVR--- 612
            ....|.|....: :...|||...:        .:|:.  ....:|..|.||.|...||.|..   
  Fly   263 GSKVLKHAAVKV-RKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETIT 326

  Fly   613 -LKGIFAGENSCGE-------GQTVRFAKPDIKWI 639
             |.||.:....||.       .:|.:|    .|||
  Fly   327 FLAGITSYGGPCGTIGWPSVFTRTAKF----YKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 59/225 (26%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 68/269 (25%)
Tryp_SPc 104..360 CDD:238113 70/270 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.