DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG31269

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:278 Identity:66/278 - (23%)
Similarity:106/278 - (38%) Gaps:65/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 LAGVCATRNKRTKPTG--VKD---LDANFAE---IPWQAMILRESSKTLICGGAIIGDQFVLSSA 464
            |..:.|.|.|.....|  .||   :....||   .|:| :.|:..|....||||||.:.|||::|
  Fly    15 LVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQ-ISLQGISGAHSCGGAIINETFVLTAA 78

  Fly   465 SCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTG----VKTVDVHPDYDPSTNSHDLAIIRLERRL 525
            .||....:..:.|..|      ||:   :...|    :|.:.:|.:||.....:|:|::.|...:
  Fly    79 HCVENAFIPWLVVVTG------TNK---YNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPI 134

  Fly   526 EFASHIQPICISDEDPKDSEQCFTSGWGK-----------QALSI----HEEGALMHVTDTLPQA 575
            .:....|||.:.....:..::...:|||.           |.|.:    |.|...:...|     
  Fly   135 AWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSND----- 194

  Fly   576 RSECSADSSSVCSATKF--DSCQFDVGSALACGSGSSVRLKGIFAGENSCGEGQTVRFAKPDI-- 636
             .:|  |...:|:.::.  .:|..|.|..|.    |:..|.|:......|..|      .||:  
  Fly   195 -EDC--DVGHICTFSRLGEGACHGDSGGPLV----SNGYLVGLVNWGWPCATG------VPDVHA 246

  Fly   637 ------KWINTAFAENNK 648
                  .||....:.|:|
  Fly   247 SVYFYRDWIRNVMSGNSK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 50/211 (24%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 55/245 (22%)
Tryp_SPc 38..258 CDD:238113 57/247 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.