DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and sphinx1

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:217 Identity:41/217 - (18%)
Similarity:77/217 - (35%) Gaps:58/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 GAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDL 516
            |.||.:|::|:..        |.::....|..|.|......|.:..:...:....||   |.|.:
  Fly    58 GTIISNQWILTVK--------TVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYD---NDHVI 111

  Fly   517 AII-----RLERRLE-------------FASHIQPICISDEDPKDSEQCFTSGWG--KQALSIHE 561
            |::     :.:||::             :..::..:|               |:|  |:...:.|
  Fly   112 ALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVC---------------GYGTEKRHAKLPE 161

  Fly   562 EGALMHVTDTLPQARSECSADSS-----SVC-SATKFDS-CQFDVGSALACGSGSSVRLKGIFAG 619
               .|...:......:||:...:     .:| |...|.. |:.|:|.|:.....:...:..|:..
  Fly   162 ---WMRCIEVEVMNNTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLM 223

  Fly   620 ENSCGEG-QTVRFAKPD-IKWI 639
            ..:|..| .:|.....| ||||
  Fly   224 PENCSIGYPSVHIRVSDHIKWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 32/190 (17%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 39/215 (18%)
Tryp_SPc 26..248 CDD:304450 41/217 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.