DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG11664

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:226 Identity:48/226 - (21%)
Similarity:82/226 - (36%) Gaps:54/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 DANFAEIPWQ----AMILRESSKTLICGGAIIGDQFVLSSASCV--NGLPVTDIRVKAG----EW 482
            ||....||.|    ..:::......:..|::...::||:.|.|.  |..| .::.|:||    .|
  Fly    21 DALHRGIPVQQQNYGYVMQIYGPQFLAAGSLFSARYVLTVAHCFKKNTKP-EELSVRAGYRWIAW 84

  Fly   483 ELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQC 547
            |....      |:.|:..   ||.:.|.|..:|:|::|::..:..:..|..|.:... |......
  Fly    85 EFRGK------QVAGLLR---HPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSR-PLTPLNM 139

  Fly   548 FT-----SGWGKQALSIHEEGALMHVTDTLPQARSECSADSSS-----------VC-SATKFDS- 594
            |.     :||.           |||:...|.....:...:.:.           :| |||..:. 
  Fly   140 FAPPQELAGWN-----------LMHIAQPLKSMSVQVEPEKNCRQWFPQISGGVICASATMGEGL 193

  Fly   595 CQFDVGSALACGSGSSVRLKGIFAGENSCGE 625
            |..|.|..|..|.    .:.|:......||:
  Fly   194 CYGDSGDPLISGG----EVCGLAIAFRKCGD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 45/215 (21%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 43/209 (21%)
Tryp_SPc 38..237 CDD:214473 43/209 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.