DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG30323

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:204 Identity:42/204 - (20%)
Similarity:77/204 - (37%) Gaps:65/204 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 CGGAIIGDQFVLSSASCVNGLP-----------------VTDIRVKAGEWELGSTNEPLPFQLTG 497
            |.|:::...:|::|..||:..|                 .|..|:|          :|.|..:..
  Fly    54 CAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLK----------KPSPKNIYH 108

  Fly   498 VKTVDVHPDYDPSTNSHDLAIIRLERRL---EFASHIQPICISDEDPKDSEQCFTSGWGK----- 554
            |:.:.:  |....:...:||:::|:|.:   .||     :.:.:::...:..|.:.|||:     
  Fly   109 VQKIVL--DESAISGCTELALLKLDRGVTGQRFA-----MMLPEKELNSTWLCNSLGWGRIYYVS 166

  Fly   555 --------QALSIHEEGALMHVTD-----TLPQARS------ECSADSSSVCSATKF----DSCQ 596
                    .|.|:..:..:....|     .|.|.|:      ||..|.|.....|.:    :.||
  Fly   167 YVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSYTGRGNMCQ 231

  Fly   597 FDVGSALAC 605
            .|:||.|.|
  Fly   232 QDLGSPLFC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 42/204 (21%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 42/204 (21%)
Tryp_SPc 45..272 CDD:214473 42/204 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435415
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.