DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG30187

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:242 Identity:65/242 - (26%)
Similarity:103/242 - (42%) Gaps:42/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 VCATRNKRTKPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDI 475
            :|.. |...|.||  ..:|.|....|.|.:  .:....||||.:|..:|||::|.|:....|..:
  Fly    27 ICGI-NIALKITG--GHNAAFQNSVWMAAV--HNRTHFICGGTLIHKRFVLTAAHCIVDQDVQSV 86

  Fly   476 RVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYD-PSTNSHDLAIIRLERRLEFASHIQPICI--- 536
                   .||:.|:..|.....|.|..||..:| .::..:|:.:::|...:.|.:.|:||||   
  Fly    87 -------SLGAYNKSDPADRKDVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLN 144

  Fly   537 -SDEDPKDSEQCFTS-GW----GKQALSIHEEGALMHVTDTLPQARSECSADSS------SVCSA 589
             |..:...:.:.|.: ||    |.:...|.:...|.|:.      |.||..:.|      .:|:.
  Fly   145 KSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLD------REECYMELSVYPSEKQICAG 203

  Fly   590 T-KFDSCQFDVGSALA-----CGSGS-SVRLKGIFAGENSCGEGQTV 629
            . ..|:|..|.|..|.     .|.|: .|:...|..|:.|| :||.|
  Fly   204 VPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSC-DGQGV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 53/210 (25%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 63/233 (27%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.