DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG30098

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:193 Identity:57/193 - (29%)
Similarity:97/193 - (50%) Gaps:25/193 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 NFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTD-IRVKAGEWELGSTNEPLPF 493
            |....||.|.::|::  ...|||::|..:|||::|.|..   :.| :.|:.||::...|.:.   
  Fly    42 NARRTPWMAYLIRDN--RFACGGSLIAYRFVLTAAHCTK---INDNLFVRLGEYDSSRTTDG--- 98

  Fly   494 QLTGVKTVDV--HPDYDPSTNSHDLAIIRLERRLEFASHIQPICI----SDEDPKDSEQCFT-SG 551
            |....:.|.:  |.:|....| ||:|:::|:|::.:.::|:||||    ..:...:|.|.|| :|
  Fly    99 QTRSYRVVSIYRHKNYIDFRN-HDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTG 162

  Fly   552 WGKQALSIHEEGALMHVTDTLPQARSE-CSADSSSVCSATKFD-SCQFDVGSALACGSGSSVR 612
            ||:.|........|..:  :|.:.|:| |...|.|:|...... :|..|.|..|    ||.|:
  Fly   163 WGQMAHYYKMPTTLQEM--SLRRVRNEYCGVPSLSICCWNPVQYACFGDSGGPL----GSLVK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 57/193 (30%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 57/193 (30%)
Tryp_SPc 37..258 CDD:238113 57/193 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.