DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG30087

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:280 Identity:65/280 - (23%)
Similarity:113/280 - (40%) Gaps:54/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 DPNYVDPWPVNLAGVCATRNKRTKPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVL 461
            |..:::|    |.||  |...:|....|...:|.....|:  |:...::....|||:|:..:::|
  Fly    22 DAQFLNP----LCGV--TYESQTAMRVVNGKEAVIRSAPF--MVYVTNNSLTHCGGSILNSRYIL 78

  Fly   462 SSASCVNGLPVTDIRVKAGEWEL-------GSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDLAII 519
            ::|.||    ..::|::.||..:       ||...|...:. |:.....|..|:.:.:.:|:|::
  Fly    79 TAAHCV----FPNLRLRLGEHNIRTDPDCQGSNCSPRSEEY-GIMKAITHRFYNAANHVNDIALL 138

  Fly   520 RLERRLEFASHIQPICISDEDPKDSEQCF---TSGWGKQALSIHEEGALMHVTDTLPQARSECSA 581
            :|.|.:.|..|||||||. .:|..:....   |.|||:.     ::....|:..|     :|..|
  Fly   139 KLNRSINFNVHIQPICIL-LNPASAPSVATYQTFGWGET-----KKNGFPHLLQT-----AELRA 192

  Fly   582 DSSSVCSAT---------------KFDSCQFDVGSALAC-----GSGSSVRLKGIFAGENSCGEG 626
            ..::.||.:               :.|:|..|.|..|..     |....::|..:..|...|...
  Fly   193 YDAAYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSP 257

  Fly   627 QTVRFAKPDIKWINTAFAEN 646
            ....:....|.||..|...|
  Fly   258 GVYTYVPNYINWIRRAMLIN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 50/217 (23%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 54/246 (22%)
Tryp_SPc 42..272 CDD:238113 56/247 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.