DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and pqn-25

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_741140.1 Gene:pqn-25 / 175759 WormBaseID:WBGene00004114 Length:672 Species:Caenorhabditis elegans


Alignment Length:163 Identity:35/163 - (21%)
Similarity:51/163 - (31%) Gaps:24/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGDYRANMFLNGQYQNGIK--------------DQKENNLLVNPSTNVFLN-HAIISRQASPFQG 72
            :|.......:|||..|.:.              .|.:||:....|..|.:| ..:||...:...|
 Worm   158 NGCLAGQTMVNGQCYNSVNIGSACQSTQQCLGGSQCQNNICQCYSGYVNVNQQCVISNGLNCQLG 222

  Fly    73 PTYLPPKEFLKCAPGQQCVRSGQCL-NGYFAQQLPKIQN--------CDPETTVCCTYRPPPTTT 128
            ......:.....:|||.|..|.||: |.....|:....|        |.|.|:..|.........
 Worm   223 TVSYNSQCITLASPGQNCQTSSQCIDNSVCMNQMCTCNNNYRLVYGYCVPITSSICQQTQTLVNN 287

  Fly   129 TTTTTSVPVANCAYDSDCVTPDNCRNGEISAIN 161
            .....|:....|..:..||....|.:|.....|
 Worm   288 QCVLLSIVGETCIANQQCVGGAMCNSGTCQCTN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113
pqn-25NP_741140.1 EB 160..211 CDD:279949 10/50 (20%)
EB 219..270 CDD:279949 11/50 (22%)
EB 278..329 CDD:279949 8/43 (19%)
EB 341..>376 CDD:279949
EB 384..435 CDD:279949
EB 450..496 CDD:279949
EB 504..555 CDD:279949
EB 563..614 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D373788at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.