DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG43742

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:238 Identity:66/238 - (27%)
Similarity:111/238 - (46%) Gaps:33/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 QAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQL------ 495
            |.|....::....|||::|..|:||::|.||..|....:       .||..|...|..:      
  Fly    45 QFMAALYNNSEFFCGGSLIHKQYVLTAAHCVRDLDEVTV-------HLGENNRSCPIPVCKHVLR 102

  Fly   496 TGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPIC-ISDED-PKDSEQCFTS-GWGKQAL 557
            ...|.: :||::..:...:|:|::||||.:.|.:||:||| |.||| ..:::..||: ||||.  
  Fly   103 LNAKVI-LHPNFHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFTAYGWGKT-- 164

  Fly   558 SIHEEGALMHV---TDTLPQARSECSADSSSVCS-ATKFDSCQFDVGSALACGSGSSVRLKGIFA 618
               |.|.:..|   .|.:...:|.|..:.:::|: :|..|:|:.|.|..|........:.:.|..
  Fly   165 ---EHGNISDVLSFIDLVRLPKSMCYQNINTICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILF 226

  Fly   619 GENSCGEGQTVRF--AKPDI----KWINTAFAENNKPLLLKRF 655
            |..|.|:.:....  ...|:    .||.:...| ::|.||..:
  Fly   227 GITSYGDAECSGLFGVYTDVNAYKSWIASVVLE-SEPRLLNEY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 55/191 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 60/220 (27%)
Tryp_SPc 35..256 CDD:238113 62/223 (28%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.