DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG43336

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:222 Identity:59/222 - (26%)
Similarity:97/222 - (43%) Gaps:40/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 ANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPF 493
            |:....||.| .|..:....||||::|.::.||::|.|.  |..|::..:.||::    .|....
  Fly    44 ASLTSSPWMA-FLHSTDGRFICGGSLITNRLVLTAAHCF--LDRTELVARLGEYD----REEYEM 101

  Fly   494 QLTGVKTVDV---------HPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPK-----DS 544
            ......|..:         |..|:|.|.::|:||:||.|::::..:|:||||. .||:     ||
  Fly   102 CHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRKVQYTDNIRPICIV-IDPRWRKYIDS 165

  Fly   545 EQCFT-SGWGKQALSIHEEG--ALMHVTDTLPQARSECSADSSSVCSATKF-------DSCQFD- 598
            ....| :||||    ...||  |.:...|...:....|...::...:|.:|       :.|..| 
  Fly   166 LDPLTGTGWGK----TESEGDSAKLRTVDLARKHPEVCRRYATLSLTANQFCAGNERSNLCNGDS 226

  Fly   599 ---VGSALACGSGSSVRLKGIFAGENS 622
               ||:.:..|........||.:..|:
  Fly   227 GGPVGALIPYGKSKRFVQVGIASFTNT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 56/214 (26%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 59/222 (27%)
Tryp_SPc 40..271 CDD:238113 59/222 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.