DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG43335

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:318 Identity:81/318 - (25%)
Similarity:120/318 - (37%) Gaps:83/318 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 AAFRVPLTDCLQTENGSPGKCCR-------DPNYVDPWPVNLAGVCATRN----KRTKPTGVKDL 427
            |||.|.::.|..        .||       :||            |..|.    .||:..|  ..
  Fly     4 AAFLVIISVCQW--------LCRFGESRLLEPN------------CGIRTMPSFHRTRIIG--GS 46

  Fly   428 DANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLP 492
            ||.....||.|.:..|..  ..|.|.:|.:||||::|.|:..  ..::.|:.|...|..::..: 
  Fly    47 DAEITSHPWMAYLYNEFH--YFCAGTLITNQFVLTAAHCIEA--SKNLTVRLGGSGLTRSDGSM- 106

  Fly   493 FQLT----GVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDP------KDSEQC 547
            .|:|    .|.....|..:.||...:|:|:|||.|.::|..||:||||. .||      :|....
  Fly   107 CQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICII-LDPAVRLLLEDGMTL 170

  Fly   548 FTSGWGKQALSIHEEGALMHVTDTLP---QARSECS------ADSSSVCSATK-FDSCQFDVGSA 602
            ..:|||.....:|.     |:....|   ..|:.||      .....:|:..| .::|..|.|..
  Fly   171 MATGWGLADKRMHP-----HLLQEAPITVMNRNVCSKLYDVAITQGQICAGDKETNTCLGDSGGP 230

  Fly   603 LACGSGSSVR----LKGIFAGENSCGEGQTVRFAKPDI--------KWINTAFAENNK 648
            |    |..|.    |:.:..|..|.|:   :....|.|        .|||...::..|
  Fly   231 L----GGVVNYYGDLRFVQYGITSFGD---IECRSPSIYTDLSTYSGWINMVVSQYRK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 58/211 (27%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 64/250 (26%)
Tryp_SPc 42..275 CDD:238113 67/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.