DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG43124

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:108 Identity:37/108 - (34%)
Similarity:62/108 - (57%) Gaps:10/108 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 PWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVK 499
            ||.|.||.:|.  :||.||:|.:.:||::|||........:|:.:|.::....|    |::|...
  Fly    41 PWLAEILSDSK--VICAGALINNLYVLTAASCFKENEKLTVRLGSGYFDKSYEN----FRVTKAY 99

  Fly   500 TVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPK 542
            ....|   .|:.|:::|.|.||:..:||.:||:|:||: :.||
  Fly   100 FWMTH---FPANNTNNLCIFRLQTEVEFKTHIRPMCIT-KSPK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 37/108 (34%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 33/100 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.