DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG42694

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:231 Identity:58/231 - (25%)
Similarity:100/231 - (43%) Gaps:46/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 WQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELG---STNEPLPFQLTG 497
            |.|.|  .:...::|.|::|..|||||:|.|:      |:..|... :||   :|..|..:.::.
  Fly    46 WLAHI--SNGTHVLCSGSLISKQFVLSAAQCI------DVHGKLFV-QLGVSNATKSPHWYTVSN 101

  Fly   498 VKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICIS-DEDPKDS----EQCFTSGWGKQAL 557
            |    |.|.:.......|:.:::|.:.:::...:.||||: :.:..|.    :...||.|    |
  Fly   102 V----VIPSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAW----L 158

  Fly   558 SIHEEGALMHVTDTLPQ-ARSECSADSS------SVCSAT--KFDSCQFDVGSALA--CGSGSSV 611
            |.::...    |..|.| :|..|..:.|      .:|:|:  :.:||..|.||||.  ...||::
  Fly   159 SKNKNPQ----TIVLSQLSRDRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNI 219

  Fly   612 ------RLKGIFAGENSCGEGQTVRFAKPDIKWINT 641
                  .::|...|.:.|.|..........:.||.|
  Fly   220 VREMLFGIRGYVNGRSWCSEPAIYIDVAECVGWIET 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 51/204 (25%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 58/231 (25%)
Tryp_SPc 46..253 CDD:214473 55/227 (24%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.