DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8245 and AT5G44250

DIOPT Version :9

Sequence 1:NP_610178.2 Gene:CG8245 / 35503 FlyBaseID:FBgn0033031 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_199238.1 Gene:AT5G44250 / 834448 AraportID:AT5G44250 Length:403 Species:Arabidopsis thaliana


Alignment Length:316 Identity:62/316 - (19%)
Similarity:116/316 - (36%) Gaps:72/316 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NEFVLAKDHDGEDSHVPIVMLLGWAGCQDRYLMKYSKIYEERGLITVRYTAPVDSLFW------- 117
            |.:...|:::|.:|.. ||::..|...::|.|..:..:|              .||.|       
plant     7 NYYWRKKNNNGGESEA-IVVVFAWMSSEERNLKNHVDLY--------------SSLLWDSLVCHS 56

  Fly   118 ---------KRSEMIPIGEKILKLIQDMNFDAHPLIFHIFSNG-GAYLYQHINLAVIKHKSPLQ- 171
                     |.:::  ....:.:|::::.....||:|..||.| .|.:|:.:.:.....::.|. 
plant    57 QFLNMFLPDKAADL--ASNVVSELVKELKAKPVPLVFASFSGGPNACMYKVLQILEGTCETGLNP 119

  Fly   172 ---------VRGVIFDSAPGERRIISLYRAITAIYGREKRCNCLAALVITITLS-----IMWFVE 222
                     :.|.|:||.|.:         .|:..|..     ||....|:.:|     .:|...
plant   120 DDCRLVRNCISGFIYDSCPVD---------FTSDLGAR-----LAVHPTTLKMSSPPKPFVWAAN 170

  Fly   223 ESISALKSLFVPSSPVRPSPFCD--LKNEANRYPQLFLYSKGDIVIPYRDVEKFIRLRRDQGIQV 285
            ...|:|..:|:.....:.:.:..  ......|.|.|.|.|:.|.:.||:.:..|....::.|..|
plant   171 GIASSLDYVFLNRFESQRAEYWQTLYSTIIMRVPYLILCSENDDLAPYQTIHNFATRLQELGGNV 235

  Fly   286 SSVCFEDAEHVKIYTKYPKQYVQCVCNFIRNCMTIPPLKEAVNSEPSESVSRVNLK 341
            ..|.:.|:.|...|......|...|..|:...       .:|.|:.:.|:.|..:|
plant   236 KLVKWNDSPHCGHYRYNQVDYKAAVSEFLSKA-------ASVYSQKTRSLDREAMK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8245NP_610178.2 DUF829 76..314 CDD:283384 52/271 (19%)
AT5G44250NP_199238.1 DUF829 129..379 CDD:283384 38/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2521
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12265
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.