DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8245 and Tmem53

DIOPT Version :9

Sequence 1:NP_610178.2 Gene:CG8245 / 35503 FlyBaseID:FBgn0033031 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001272741.1 Gene:Tmem53 / 68777 MGIID:1916027 Length:283 Species:Mus musculus


Alignment Length:291 Identity:96/291 - (32%)
Similarity:147/291 - (50%) Gaps:34/291 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LEYFIKFPKPSSKNEFVLAKDHDGEDS---------HVPIVMLLGWAGCQDRYLMKYSKIYEERG 102
            |:|.|:.|.....::   :.:.|.|::         ..|:|:||||.||:|:.|.|||.||.:||
Mouse     6 LDYSIEIPDQPCWSQ---SMEGDWEENRQGGKEAGKQQPVVILLGWGGCRDKNLAKYSAIYHKRG 67

  Fly   103 LITVRYTAPVDSLFWKRSEMIP----IGEKILKLIQDMNFDAHPLIFHIFSNGGAYLYQHINLAV 163
            .|.:|||||...:|:..|..||    |.:|:|:|:.|...:..||:||:|||.|..||:::...:
Mouse    68 CIVIRYTAPWHMVFFSESLGIPSLRVIAQKLLELLFDYEIEREPLLFHVFSNAGVMLYRYVLELL 132

  Fly   164 IKHK--SPLQVRGVIFDSAPGERRIISLYRAITAIYGREK---RCNCLAALVITITLSIMWFVEE 223
            ..|:  ..|.|.|.||||.||:..:|...||:..|..|..   |...|||..:.:.|        
Mouse   133 QTHQRFRHLHVVGTIFDSGPGDSNLIGALRALATILERRPAVLRLLLLAAFALVVIL-------- 189

  Fly   224 SISALKSLFVPSSPVRPSPFCD-LKNEANRYPQLFLYSKGDIVIPYRDVEKFIRLRRDQGIQVSS 287
                ...|..|.:.:..:.|.| |::..:.:|:|:|||:.|.|:..||||:.:..|....:.|..
Mouse   190 ----FHFLLAPFTALFHTHFYDRLQDSGSCWPELYLYSRADKVVSARDVERMVEARLAHQVMVRG 250

  Fly   288 VCFEDAEHVKIYTKYPKQYVQCVCNFIRNCM 318
            |.|..:.||.....||..|.....:|:.||:
Mouse   251 VDFVSSAHVSHLRDYPTYYTSLCVDFMHNCV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8245NP_610178.2 DUF829 76..314 CDD:283384 87/247 (35%)
Tmem53NP_001272741.1 DUF829 41..277 CDD:310367 87/247 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845424
Domainoid 1 1.000 147 1.000 Domainoid score I4500
eggNOG 1 0.900 - - E1_KOG2521
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41573
Inparanoid 1 1.050 153 1.000 Inparanoid score I4327
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55732
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002525
OrthoInspector 1 1.000 - - oto93169
orthoMCL 1 0.900 - - OOG6_103942
Panther 1 1.100 - - LDO PTHR12265
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3675
SonicParanoid 1 1.000 - - X1896
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.