DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8245 and T24H10.4

DIOPT Version :9

Sequence 1:NP_610178.2 Gene:CG8245 / 35503 FlyBaseID:FBgn0033031 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_495945.2 Gene:T24H10.4 / 188870 WormBaseID:WBGene00012002 Length:337 Species:Caenorhabditis elegans


Alignment Length:326 Identity:86/326 - (26%)
Similarity:142/326 - (43%) Gaps:59/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EREDTLEYFIKFPKPSSK---NEFVLAKDHDGEDSHVPIVMLLGWAGCQDRYLMKYSKIYEERGL 103
            |.||     |...|..||   ||..:.....|..:   :|:|.|||||:||||.||::.|::.|:
 Worm    32 EAED-----ITINKEESKKSGNEAAIKNVVAGSKT---LVVLFGWAGCRDRYLSKYAQYYQDAGI 88

  Fly   104 ITVRYTAPVDSL--FWKRSEMIPIGEKIL-KLIQDMNFDAHPLIFHIFSNGG-----AY---LYQ 157
            .|||:|||:..:  |...........:|| :::.|.| |...:.||:||..|     ||   |..
 Worm    89 STVRFTAPIAKIRSFSSYRPFALCFHRILNEILHDQN-DITTIYFHVFSMNGCSLLAAYWDQLQD 152

  Fly   158 HINLAVIKHKSPLQVRGVIFDSAPG------ERRIISLYRAITAIYGREKRCNCLAALVITITL- 215
            ..|...:..||    ||:||||.|.      ..:.||......:.|....|.:..|.|....:. 
 Worm   153 LENGKEVLSKS----RGLIFDSCPAFTSPSQSAQAISFATLPPSHYHGALRGSYRAVLYTFFSFH 213

  Fly   216 -SIMW---FVEESI-----SALKSLFVPSSPVRPSPFCDLKNEANRYPQLFLYSKGDIVIPYRDV 271
             .::|   |:|:.|     :..|.:...:.|.:               ||::|...|:|.....:
 Worm   214 RGVLWLRSFLEKDIYERHYAYFKMITFDNLPAK---------------QLYIYGPADLVCSEESI 263

  Fly   272 EKFIRLRRDQGIQVSSVCFEDAEHVKIYTKYPKQYVQCVCNFIRNCMTIPPLKEAVNSEPSESVS 336
            |::.:|...:|:.:|.:...|:.|.:....:|..|.|...:|::: ..:|..:..|..|.:|..:
 Worm   264 EEYAQLMEQRGVSISKLRLLDSLHCQHLRSHPVTYTQECLDFVKS-GHLPANRSRVPLEITEEAA 327

  Fly   337 R 337
            :
 Worm   328 Q 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8245NP_610178.2 DUF829 76..314 CDD:283384 71/264 (27%)
T24H10.4NP_495945.2 DUF829 61..306 CDD:283384 71/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163602
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2521
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41573
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55732
OrthoDB 1 1.010 - - D358370at33208
OrthoFinder 1 1.000 - - FOG0002525
OrthoInspector 1 1.000 - - otm14517
orthoMCL 1 0.900 - - OOG6_103942
Panther 1 1.100 - - LDO PTHR12265
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1896
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.720

Return to query results.
Submit another query.