DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8245 and T10B11.6

DIOPT Version :9

Sequence 1:NP_610178.2 Gene:CG8245 / 35503 FlyBaseID:FBgn0033031 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_491980.1 Gene:T10B11.6 / 172424 WormBaseID:WBGene00020402 Length:325 Species:Caenorhabditis elegans


Alignment Length:314 Identity:88/314 - (28%)
Similarity:139/314 - (44%) Gaps:72/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YFIK-FPKPS-----SKNE------FVLAKDHDGEDSHVPIVMLLGWAGCQDRYLMKYSKIYEER 101
            ||.: .|:|.     ||::      .||:..|  .|...|:::::||||...:::.||.|:|.:.
 Worm    32 YFTRHVPEPKMMIHLSKSQDVTVDSIVLSDSH--HDEKKPVILMVGWAGANPKHIDKYIKVYNDE 94

  Fly   102 GLITV-------RYTAPVDSL-FWKRSEMIPIGEKILKLIQDM-NFDAHPLIFHIFS-NGGAYLY 156
            |...|       .|:.|...: |:    |.|:...|.....|. :|...|:|.|.|| ||...|.
 Worm    95 GYRVVSLCPPCYHYSIPNSRVGFY----MSPLFRAIDAKPGDFRSFAKCPIIVHSFSMNGVRGLI 155

  Fly   157 QHINLAVIKHKSPL--QVRGVIFDSAPGERRIISLYRAITAIYGREKRCNCLAALVIT---ITLS 216
            ........:.|..|  :::|:||||||...            ||::.    ..|:||:   |...
 Worm   156 SFWKWTEAEEKPQLRERIKGIIFDSAPSRP------------YGKQD----ATAMVISTPPIDAF 204

  Fly   217 IMWFVEES-ISAL-------KSLFVPSSPVRPSPFCDLKNEANRY-----------PQLFLYSKG 262
            ..|..|:: ||.|       ..|.:|...:.|.    |::..:.|           .||:||||.
 Worm   205 ERWISEQTRISVLTWFLNLRAYLQIPLLTMVPF----LRSFVSIYYYLQTHIALPRDQLYLYSKA 265

  Fly   263 DIVIPYRDVEKFIRLRRDQGIQVSSVCFEDAEHVKIYTKYPKQYVQCVCNFIRN 316
            |.:|..:.|||||..::::|..|:::.|.|:|||.....:||.|.....||:|:
 Worm   266 DTMIKAKHVEKFIEKQKEKGNSVTAIDFVDSEHVAHIRTHPKDYRTACLNFVRH 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8245NP_610178.2 DUF829 76..314 CDD:283384 76/271 (28%)
T10B11.6NP_491980.1 DUF829 69..317 CDD:283384 76/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163605
Domainoid 1 1.000 82 1.000 Domainoid score I5398
eggNOG 1 0.900 - - E1_KOG2521
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41573
Inparanoid 1 1.050 85 1.000 Inparanoid score I3739
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55732
OrthoDB 1 1.010 - - D916101at2759
OrthoFinder 1 1.000 - - FOG0002525
OrthoInspector 1 1.000 - - otm14517
orthoMCL 1 0.900 - - OOG6_103942
Panther 1 1.100 - - O PTHR12265
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3675
SonicParanoid 1 1.000 - - X1896
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.