DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8245 and XB5749398

DIOPT Version :9

Sequence 1:NP_610178.2 Gene:CG8245 / 35503 FlyBaseID:FBgn0033031 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_004920195.2 Gene:XB5749398 / 100486876 XenbaseID:XB-GENE-5749399 Length:378 Species:Xenopus tropicalis


Alignment Length:338 Identity:70/338 - (20%)
Similarity:125/338 - (36%) Gaps:103/338 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GTATQYKESTATIQTSGLQ------------SSPRSFLPEREDTLEYFIKFPKPSSKNEFVLAKD 67
            |:..:.:.|:...|:|.::            |.|||..|.|                        
 Frog    98 GSPPKAQASSEPFQSSNVKKYSHSVFLYTDPSVPRSCWPSR------------------------ 138

  Fly    68 HDGEDSHVPIVMLLGWAGCQDRYLMKYSKIYEERGLITVRYTAPVDSLFWKRSEMIPIGEKILKL 132
                    |::::|.|.|.:.....||..:|.:.|...:...:.|....|....:...|..:..|
 Frog   139 --------PLLLMLPWLGSKAHSYEKYIHLYFKLGFDVLVAESFVSHFLWPSKGLDYAGNLLNLL 195

  Fly   133 IQDMNFDAHPLIFHIFSNGGAYLYQHINLAVI----KHKSPLQ-VRGVIFDS---------APGE 183
            ..:.:..:..|..|.||.|| |.:..:.::.|    ||:..|: ::|.:|||         |.|.
 Frog   196 SAEKDLASRSLYVHAFSIGG-YTFAQMLVSSISNHKKHREMLERIQGQVFDSLVVGSMERMATGV 259

  Fly   184 RRIISLYRAITAIYGREKRCNCLAALVITITLSIMWFVEESISALKSLFVP----------SSPV 238
            .|:::|                .|...|.:..::::|     |.||:..|.          :|||
 Frog   260 ARMVAL----------------PAFQQIIVNGTLLYF-----SLLKAYTVDYYEKGIQTFWNSPV 303

  Fly   239 RPSPFCDLKNEANRYPQLFLYSKGDIVIPYRDVEKFIRLRRDQGIQVSSVCFEDAEHVKIYTKYP 303
            .    |         |.||.|...|.:..:..||:.::....|||||.:..:..:.|.....|:|
 Frog   304 T----C---------PALFFYCMDDPLSDHNVVEELLKDWEKQGIQVKAKRWNSSTHAGHLRKHP 355

  Fly   304 KQYVQCVCNFIRN 316
            ::|.:.:..||::
 Frog   356 QEYTETLNTFIQS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8245NP_610178.2 DUF829 76..314 CDD:283384 58/261 (22%)
XB5749398XP_004920195.2 DUF829 139..366 CDD:399017 58/261 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.