DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8245 and tmem53

DIOPT Version :9

Sequence 1:NP_610178.2 Gene:CG8245 / 35503 FlyBaseID:FBgn0033031 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001107322.1 Gene:tmem53 / 100135126 XenbaseID:XB-GENE-1018172 Length:289 Species:Xenopus tropicalis


Alignment Length:301 Identity:96/301 - (31%)
Similarity:161/301 - (53%) Gaps:34/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EDTLEYFIKFPKPSSKNEFVLAKDHDGEDSHVPIVMLLGWAGCQDRYLMKYSKIYEERGLITVRY 108
            :..|:|.|:||:|:       .:|...:....|:|:||||.||:|:||.||..||..:|...::|
 Frog     7 DSELDYTIEFPEPT-------FQDWQWDREQEPVVILLGWGGCKDQYLTKYGAIYHNKGCTVIKY 64

  Fly   109 TAPVDSLFWKR----SEMIPIGEKILKLIQDMNFDAHPLIFHIFSNGGAYLYQHINLAVIKH--K 167
            ||..:::|...    |.:....:|:|:|:.:...:..|::||:|||||..||::|...:..|  .
 Frog    65 TAAWNAVFVTESLGLSSLREEAKKLLELLFEYEIEKSPILFHVFSNGGFMLYRYIVELLQSHCRL 129

  Fly   168 SPLQVRGVIFDSAPGERRIISLYRAITAIY----GREKRCNCLAALVITITLSIMWFVEESISAL 228
            :.|.|.|.|||||||.|.:|...||:..|.    .:..|...|||..:.:.:            |
 Frog   130 NKLHVVGTIFDSAPGNRNVIGSVRALDTILRTSTNKAFRFLALAAFALMVII------------L 182

  Fly   229 KSLFVP-SSPVRPSPFCDLKNEANRYPQLFLYSKGDIVIPYRDVEKFIRLRRDQGIQVSSVCFED 292
            :.|..| :..|..:.:..:|.:.:|:|||:|||:.|.:|.|.|||..|..||.:.:...::.|..
 Frog   183 RILLYPVTRYVHENHYDAMKKDPSRWPQLYLYSRADPIISYLDVESIIAARRRRCLPTEALDFGK 247

  Fly   293 AEHVKIYTKYPKQYVQCVCNFIRNCMTIPPLKEAVNSEPSE 333
            :|||..:.::|::|.:...:|:|:|:.    |.|::...||
 Frog   248 SEHVSHFRRFPQRYSETCTSFLRDCVR----KAAISMLSSE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8245NP_610178.2 DUF829 76..314 CDD:283384 82/248 (33%)
tmem53NP_001107322.1 DUF829 32..269 CDD:283384 82/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4600
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41573
Inparanoid 1 1.050 157 1.000 Inparanoid score I4173
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D358370at33208
OrthoFinder 1 1.000 - - FOG0002525
OrthoInspector 1 1.000 - - oto103425
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1896
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.