DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1344 and SCYL1

DIOPT Version :9

Sequence 1:NP_001260711.1 Gene:CG1344 / 35500 FlyBaseID:FBgn0027507 Length:683 Species:Drosophila melanogaster
Sequence 2:XP_024304387.1 Gene:SCYL1 / 57410 HGNCID:14372 Length:847 Species:Homo sapiens


Alignment Length:378 Identity:92/378 - (24%)
Similarity:152/378 - (40%) Gaps:73/378 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AIKNLMVYRHPYILKYIATWEKSGRKYLATERVRPLDEVLAQQT------DIEVCLGLRTILCAL 126
            |.|.....|||.||.||...|.....::.||.|.||...|..:.      ::|:..||..|:.||
Human    64 AFKRFKTLRHPNILAYIDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKAL 128

  Fly   127 IFLVEKALARHLNINTQSIYVTESGSWRLAGFEYVWRATDVN----------------KQLLDLA 175
            .|||......|.|:...:::|..:|.|:|.|.:|::.|....                .:|.|.:
Human   129 SFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSS 193

  Fly   176 HSFIDLTIHGENFEQFFFSILC----------EKVLSRKGTDSCITDSTPHVHEFREYCSTHLKH 230
            ...:     .|.:....:.:.|          .:..:.:..........||      ||  .|..
Human   194 GRVV-----REKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPH------YC--ELVG 245

  Fly   231 QNTKLRPRLSAILLH-----PYFNHEFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVA 290
            .|.|:||..:..|.:     .:.::.||..:.||.|:.:|...|:.|||:.|...|..|.|:...
Human   246 ANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCR 310

  Fly   291 SQLACDLLSRMVLLDPAAQEF-------VTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFR 348
            .::...||:        |.||       :||..   ||     ....|.:.|.|.::|.::|||.
Human   311 HKVLPQLLT--------AFEFGNAGAVVLTPLF---KV-----GKFLSAEEYQQKIIPVVVKMFS 359

  Fly   349 LRDAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRCM 401
            ..|..:|:.||.....:::.|.:..:.::|.||:..|..|||..:..:|::.|
Human   360 STDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSM 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1344NP_001260711.1 PKc_like 24..>170 CDD:304357 34/123 (28%)
SCYL1XP_024304387.1 PK_SCY1_like 20..296 CDD:270913 58/244 (24%)
HEAT repeat 314..336 CDD:293787 7/32 (22%)
HEAT repeat 350..378 CDD:293787 8/27 (30%)
HEAT repeat 388..418 CDD:293787 9/25 (36%)
HEAT repeat 427..454 CDD:293787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1074965at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.