DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hrm and MCH2

DIOPT Version :9

Sequence 1:NP_001286141.1 Gene:hrm / 35499 FlyBaseID:FBgn0033028 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_012701.2 Gene:MCH2 / 853659 SGDID:S000001704 Length:473 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:59/244 - (24%)
Similarity:109/244 - (44%) Gaps:26/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HKEKIINSQNASKINQKDHKPNGNTNESRHKTVSLINKKDDKEYDLVPPDGGWGWLVLLGSCLTN 66
            |::...:.:|...:|.|| ..||||:.|                 :..||||:||.:||...|.|
Yeast     6 HEDHHRDVENKLNLNGKD-DINGNTSIS-----------------IEVPDGGYGWFILLAFILYN 52

  Fly    67 ILIPGTIKSFGVLFSEF--TDAF-NSSPTKAAWIPALCYFLYSSLGPVSSILSVKYSYRTVTLLG 128
            ....|....:.:..:.:  .:.| ..|....|.|..|.:.......||.:.|...:|.:.:..||
Yeast    53 FSTWGANSGYAIYLAHYLENNTFAGGSKLDYASIGGLAFSCGLFFAPVITWLYHIFSIQFIIGLG 117

  Fly   129 GASASLGMILSFWASSIEFLYISYGVLVGIGAGLSFPPTVYIVTSYFAKLRGLANGLCISGSALG 193
            .......::|:.::.::..:|::.|||:|.|....|.|:|.::..:|...|.||:|:..:||.||
Yeast   118 ILFQGAALLLAAFSVTLWEIYLTQGVLIGFGLAFIFIPSVTLIPLWFRNKRSLASGIGTAGSGLG 182

  Fly   194 SIILPPLLRWLLETYGYH----GSCLIMGGI-TLNVFVAALFYEPVEQH 237
            .|:....::.:|:..|..    ..|:|...: |:.:.:....::.:.||
Yeast   183 GIVFNLGMQSILQKRGVKWALIAQCIICTSLSTIALMLTRTTHQGLRQH 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hrmNP_001286141.1 2A0113 49..653 CDD:273325 49/197 (25%)
MFS 59..>234 CDD:119392 41/182 (23%)
MFS <449..633 CDD:119392
MCH2NP_012701.2 MFS_MCT_SLC16 41..428 CDD:340910 45/191 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000033
OrthoInspector 1 1.000 - - mtm13433
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.