DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hrm and ATG22

DIOPT Version :9

Sequence 1:NP_001286141.1 Gene:hrm / 35499 FlyBaseID:FBgn0033028 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_009892.1 Gene:ATG22 / 850319 SGDID:S000000543 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:57/255 - (22%)
Similarity:91/255 - (35%) Gaps:84/255 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WGWLVLLGS-----CLTNILI-----------PGTIKSFGVLFSEFTDAFNSSPTKAAWIPALCY 102
            :||:.|..|     .|.:::|           ..||.|..||||:  ...:.|......|..|. 
Yeast   301 YGWVSLFESFKHARLLKDVMIFLIAWFIISDSITTINSTAVLFSK--AELHMSTLNLIMISVLT- 362

  Fly   103 FLYSSLGP--VSSILSVKYSYRTVTLLGGASASLGMILSFWASSIEFLYISYGVLVGI---GAGL 162
            .:.:.||.  :...|:.|:.:        .|:...|.:..|||.|.|    ||:| |.   ..||
Yeast   363 VVNAMLGAFMIPQFLATKFRW--------TSSQTLMYIIIWASFIPF----YGIL-GFFFNAFGL 414

  Fly   163 SFPPTVYIVTSYFAKLRGLA-NGLCISGSALGSIILPPLLRWLLETYGYHGSCLIMGGIT----- 221
            .....::::..::    ||: .||.....::.|:|:||         |...:...|..||     
Yeast   415 KHKFEMFLLAIWY----GLSLGGLSAVSRSVFSLIVPP---------GKESTFFSMFSITDKGSS 466

  Fly   222 -LNVFVAALFYEPVEQHMVR---------------------VPRARQALEN----IPEEE 255
             |..|:..|..:  :.|.:|                     |.|.|:..|.    :||.|
Yeast   467 ILGPFLVGLLTD--KTHNIRYSFYFFFLLLMLSLPVLNCLDVKRGRREAEELSQVLPESE 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hrmNP_001286141.1 2A0113 49..653 CDD:273325 57/255 (22%)
MFS 59..>234 CDD:119392 46/202 (23%)
MFS <449..633 CDD:119392
ATG22NP_009892.1 MFS_Atg22_like 28..484 CDD:341036 49/213 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.