DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hrm and AT2G34355

DIOPT Version :10

Sequence 1:NP_610174.1 Gene:hrm / 35499 FlyBaseID:FBgn0033028 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_850229.2 Gene:AT2G34355 / 817998 AraportID:AT2G34355 Length:523 Species:Arabidopsis thaliana


Alignment Length:224 Identity:47/224 - (20%)
Similarity:80/224 - (35%) Gaps:53/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 DGSYADVDARGQAQQPQRSKFFDLSLLKDPMYLVILISNSTNAISYTNFIIL------------- 477
            ||...|..|   ...|..|..|     .|..:||...||...|:|..||.:|             
plant   275 DGPVLDTSA---LLDPPSSNIF-----PDGDHLVAEDSNILEAMSTVNFWLLFLAMLCGMGSGFA 331

  Fly   478 ----LPSFGEARGFNKSLSAYLLSVVSATDLIGRIGGSALSDMGYIPKTW-------YFVGGLSI 531
                :...||:..::......|:|:.|..:.:||.|...:||......:|       ..:|.::|
plant   332 TVNNMRQIGESLRYSSVQLNSLVSLWSIWNFLGRFGAGYVSDTFLHKHSWPRPIFMAITLGVMAI 396

  Fly   532 SGLSLALLPFAWTYSSVCFWCALFGLASGIYVGITAVIMADMLGTERLTSSYGISLFVNGLLQLV 596
            ..:.:|    :....|:.....|.|:|.|....:...|.:::.|...:.:.|    |.   :.:.
plant   397 GHIIVA----SGVQGSLYAGSVLIGMAYGSQWSLMPTITSEIFGIRHMGTIY----FT---ISIA 450

  Fly   597 GP--------PLCNYWFEAV--NDYNPLF 615
            ||        .:..|:::.|  .|.|..|
plant   451 GPIGSYILSVKVIGYFYDKVASEDDNSCF 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hrmNP_610174.1 MFS_MCT_SLC16 55..>231 CDD:340910
MFS <451..633 CDD:475125 40/199 (20%)
AT2G34355NP_850229.2 MFS_Mch1p_like 7..498 CDD:340912 47/224 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.