Sequence 1: | NP_001286141.1 | Gene: | hrm / 35499 | FlyBaseID: | FBgn0033028 | Length: | 658 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001037956.1 | Gene: | LOC733714 / 733714 | -ID: | - | Length: | 425 | Species: | Xenopus tropicalis |
Alignment Length: | 197 | Identity: | 54/197 - (27%) |
---|---|---|---|
Similarity: | 78/197 - (39%) | Gaps: | 29/197 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 450 SLLKDPMY----LVILISNSTNAISYTNFII--------LLPSFGEARGFNKS--LSAYLLSVVS 500
Fly 501 ATDLI-GRIGGSALSDMGYIPKTWYFVGGLSISGLSLALLPFAWTYSSVCFWCALFGLASGIYVG 564
Fly 565 ITAVIMADMLG------TERLTSSYGISLFVNGLLQLVGPPLCNYWFEAVNDYNPLFHALGLTLL 623
Fly 624 AG 625 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hrm | NP_001286141.1 | 2A0113 | 49..653 | CDD:273325 | 54/197 (27%) |
MFS | 59..>234 | CDD:119392 | |||
MFS | <449..633 | CDD:119392 | 54/197 (27%) | ||
LOC733714 | NP_001037956.1 | MFS_1 | 94..370 | CDD:284993 | 42/142 (30%) |
2_A_01_02 | 96..237 | CDD:273318 | 41/140 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D916876at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |