DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hrm and LOC733714

DIOPT Version :9

Sequence 1:NP_001286141.1 Gene:hrm / 35499 FlyBaseID:FBgn0033028 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_001037956.1 Gene:LOC733714 / 733714 -ID:- Length:425 Species:Xenopus tropicalis


Alignment Length:197 Identity:54/197 - (27%)
Similarity:78/197 - (39%) Gaps:29/197 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 SLLKDPMY----LVILISNSTNAISYTNFII--------LLPSFGEARGFNKS--LSAYLLSVVS 500
            :||.|..|    ..:|::||:.:..|.:.||        ....:.|....|:.  |...||::.:
 Frog    39 ALLYDTEYGNRNTTVLLNNSSGSSLYRDSIINNTESAGNQTQCYEEKDYLNEENVLVGLLLAIKA 103

  Fly   501 ATDLI-GRIGGSALSDMGYIPKTWYFVGGLSISGLSLALLPFAWTYSSVCFWCALFGLASGIYVG 564
            ...|: ..|.|..::..||....:.   |..|..||..:..||.:|:   |.|...|| .||...
 Frog   104 LLQLLTNPIVGKIINRTGYDAPLFC---GTIIMFLSTLMFAFADSYA---FLCVARGL-QGIGSS 161

  Fly   565 ITAVIMADMLG------TERLTSSYGISLFVNGLLQLVGPPLCNYWFEAVNDYNPLFHALGLTLL 623
            .|||....||.      .|| ..:.||:|....:..|.|||..:..:|.|....|......|.||
 Frog   162 FTAVPALGMLAHVFPDDAER-GKAMGIALSGVAIGVLAGPPFGSAMYEFVGKSAPFLAIAALALL 225

  Fly   624 AG 625
            .|
 Frog   226 DG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hrmNP_001286141.1 2A0113 49..653 CDD:273325 54/197 (27%)
MFS 59..>234 CDD:119392
MFS <449..633 CDD:119392 54/197 (27%)
LOC733714NP_001037956.1 MFS_1 94..370 CDD:284993 42/142 (30%)
2_A_01_02 96..237 CDD:273318 41/140 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.