DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hrm and slcf-1

DIOPT Version :9

Sequence 1:NP_001286141.1 Gene:hrm / 35499 FlyBaseID:FBgn0033028 Length:658 Species:Drosophila melanogaster
Sequence 2:NP_509762.2 Gene:slcf-1 / 186633 WormBaseID:WBGene00010340 Length:450 Species:Caenorhabditis elegans


Alignment Length:223 Identity:46/223 - (20%)
Similarity:77/223 - (34%) Gaps:53/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QNASKINQKDHKPNGNTNESRHKTVSLINKKDDKEYDLVPPDGGWG--WLVLLGSCLTNILIPGT 72
            :.|::.|.:..:|.|    :|...|          :|..|....|.  |:.:.|           
 Worm     4 ERATRQNVRRGRPPG----TRRAVV----------FDDTPQPSEWRNIWVAICG----------- 43

  Fly    73 IKSFGVLFSE-----------------FTDAFNSSPTKAAWIPALCYFLYSSLGPVSSILSVKYS 120
               |.:||:|                 :....:.:.|....:|.....:   |||..||...:..
 Worm    44 ---FYILFAETGVRQVMNGFVEPVIKTYNCTKDQADTAVLVVPMASSLI---LGPFCSIFYQRSG 102

  Fly   121 YRTVTLLGGASASLGMILSFWASSIEFLYI-SYGVLVGIGAGLSFPPTVYIVTSYFAKLRGLANG 184
            .|...:.|........::..:..:|..|.: ::|  :|||.||.....:.|...||.|.|.....
 Worm   103 ARISIIAGSFLTGGSFVVGPFCKNIYLLMLATFG--MGIGCGLMRNSIISIQCEYFKKKRNTVMA 165

  Fly   185 LCISGSALGSIILPPLLRWLLETYGYHG 212
            ....|..||..|||..|::::..|...|
 Worm   166 AISIGPGLGIFILPRTLKFIMVKYNSWG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hrmNP_001286141.1 2A0113 49..653 CDD:273325 39/184 (21%)
MFS 59..>234 CDD:119392 36/172 (21%)
MFS <449..633 CDD:119392
slcf-1NP_509762.2 MFS 44..410 CDD:119392 35/155 (23%)
MFS_1 79..376 CDD:284993 30/120 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.