DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CABP1

DIOPT Version :10

Sequence 1:NP_610173.2 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_016875724.1 Gene:CABP1 / 9478 HGNCID:1384 Length:405 Species:Homo sapiens


Alignment Length:128 Identity:24/128 - (18%)
Similarity:41/128 - (32%) Gaps:56/128 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DRLILRYVNRKL---RNFVDNKKPIFKNVKVYSVVGGYNLVLGHDKSTIFYDSKGSGCIARCDGR 109
            |..:.||:..|:   ...:.|::|:                  :||                   
Human   120 DEEVRRYIMEKIVQANKLLQNQEPV------------------NDK------------------- 147

  Fly   110 RMRKIN-KSSLAALFGDLEV-----------WMKNPQLQLDKFSLYAVCDDELTTNLLKKITN 160
            |.||:. |..|.    ||||           :.:|.:....|.|...:.:|....::|..:||
Human   148 RERKLKFKDQLV----DLEVPPLEDTTTFKNYFENERNMFGKLSQLCISNDFGQEDVLLSLTN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_610173.2 PTZ00184 1..152 CDD:185504 21/118 (18%)
CABP1XP_016875724.1 PTZ00184 221..362 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.