DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and EFCAB12

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_011511595.1 Gene:EFCAB12 / 90288 HGNCID:28061 Length:610 Species:Homo sapiens


Alignment Length:101 Identity:19/101 - (18%)
Similarity:39/101 - (38%) Gaps:28/101 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EPPAVKALIKEVDKGTTGKLDFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVAT 110
            ||||:..:             :|.......:.:|:...||..:|:     |:..:|   ::....
Human   221 EPPALSVM-------------YSYLHSRKIKILEIFHKVGQGENQ-----RITREE---FIAAVK 264

  Fly   111 LRGILHELDDKLSNQDLDMIIEEIDADGS-GTVDFD 145
            ..|:      .|.||:::.|:..:.:.|. .|:..|
Human   265 AVGV------PLKNQEVEDIVIYLSSLGKHNTITMD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 19/101 (19%)
EFh 14..75 CDD:238008 5/28 (18%)
EFh 90..152 CDD:238008 10/57 (18%)
EFCAB12XP_011511595.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.