DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and CMD1

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_009667.1 Gene:CMD1 / 852406 SGDID:S000000313 Length:147 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:43/145 - (29%)
Similarity:86/145 - (59%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQFCK 72
            :||:...:.||..||.|..|||..:::::::..||.......|..|:.|:|.....:::||:|..
Yeast     7 EEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLA 71

  Fly    73 LAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDAD 137
            |.:|.::..:.    :.||.|||:|:||.|.|.::.|.|:.:|..:.:||::.::|.::.|: :|
Yeast    72 LMSRQLKSNDS----EQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREV-SD 131

  Fly   138 GSGTVDFDEFMQVMT 152
            |||.::..:|..:::
Yeast   132 GSGEINIQQFAALLS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 43/143 (30%)
EFh 14..75 CDD:238008 18/60 (30%)
EFh 90..152 CDD:238008 22/61 (36%)
CMD1NP_009667.1 PTZ00184 1..145 CDD:185504 43/142 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.