DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and Cetn2

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_215222.5 Gene:Cetn2 / 84593 RGDID:620247 Length:255 Species:Rattus norvegicus


Alignment Length:147 Identity:47/147 - (31%)
Similarity:88/147 - (59%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQ 69
            |..:||.:.:|.||..||.||.|:|:..::...:..||.:.:...:|.:|.|:||..|||::||.
  Rat   107 ELTEEQKQEIREAFDLFDADGTGTIDMKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSD 171

  Fly    70 FCKLAARFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEI 134
            |..:..:.:. |:|.   :.|:.:||:::|.:..|.::...|:.:..||.:.|::::|..:|:|.
  Rat   172 FLTVMTQKMS-EKDT---KEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEA 232

  Fly   135 DADGSGTVDFDEFMQVM 151
            |.||.|.|:..||:::|
  Rat   233 DRDGDGEVNEQEFLRIM 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 47/147 (32%)
EFh 14..75 CDD:238008 22/60 (37%)
EFh 90..152 CDD:238008 20/62 (32%)
Cetn2XP_215222.5 PTZ00183 99..255 CDD:185503 47/147 (32%)
EFh 115..177 CDD:238008 22/61 (36%)
EFh 188..250 CDD:238008 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.