DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC4 and AT1G73630

DIOPT Version :9

Sequence 1:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_177504.1 Gene:AT1G73630 / 843697 AraportID:AT1G73630 Length:163 Species:Arabidopsis thaliana


Alignment Length:142 Identity:34/142 - (23%)
Similarity:72/142 - (50%) Gaps:14/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVD---KGTTGKLDFSQFCKLAA 75
            |:..|..||.:|.|.|..:::.::.:.:|.......:..::.|:|   .|...:.:|:..|:.::
plant    21 LKKVFDKFDANGDGKISVSELGNVFKSMGTSYTEEELNRVLDEIDIDCDGFINQEEFATICRSSS 85

  Fly    76 RFIEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSG 140
            ..:|:           :|||.:||:...|.::.:.:..:|:.|....|.:|...:|..:|.||.|
plant    86 SAVEI-----------REAFDLYDQNKNGLISSSEIHKVLNRLGMTCSVEDCVRMIGHVDTDGDG 139

  Fly   141 TVDFDEFMQVMT 152
            .|:|:||.::|:
plant   140 NVNFEEFQKMMS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 33/140 (24%)
EFh 14..75 CDD:238008 13/63 (21%)
EFh 90..152 CDD:238008 19/61 (31%)
AT1G73630NP_177504.1 PTZ00184 20..152 CDD:185504 34/142 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.